PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005406P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 237aa    MW: 26979.5 Da    PI: 7.1509
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005406P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv  +  +G  +W+++++  g++R++k+c++rw +yl
   MELO3C005406P1 14 KGPWTAEEDKKLVTFILTYGHCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.16.3e-1672111647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
   MELO3C005406P1  72 ETEEQLVIDLHAHLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                      67***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-22562IPR009057Homeodomain-like
PROSITE profilePS5129414.089961IPR017930Myb domain
SuperFamilySSF466893.14E-2711108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002495.3E-151461IPR001005SANT/Myb domain
CDDcd001673.08E-91661No hitNo description
PROSITE profilePS5129427.10362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-2463117IPR009057Homeodomain-like
SMARTSM007171.0E-1366114IPR001005SANT/Myb domain
PfamPF002494.9E-1472111IPR001005SANT/Myb domain
CDDcd001671.16E-972112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVTFIL TYGHCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL DETEEQLVID LHAHLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHQPLK KQQTESSSQG SSTDSSVAIT TPLSEANSNA KEQPLSNHIW MEALDQDESW  180
WNFPTWGTEI YSDFGLYSSE DSLNRLLDYY KELGDEDFEL SSLGDFNRLV GIAEKN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008467265.11e-177PREDICTED: protein ODORANT1
SwissprotQ50EX66e-88ODO1_PETHY; Protein ODORANT1
TrEMBLV5K8K71e-98V5K8K7_9R
STRINGPOPTR_0015s14600.12e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.12e-86myb domain protein 85